PS3 delayed till march in Europe ... USA and Jap as planned. ... Always the same with those idiots.

_________________
- Proud Member Of The Belgian Amigaclub Since 2003 -

The Belgian Amiga Club on FACEBOOK !

The Belgian Amiga Club Website

yeah it's unfair. At least OS4 is delayed for the whole planet. fair enough.

_________________

@Aminicle

pathetic - and apparently its our own fault for having too many languages, which is why we lost out when the yeilds didn't work out... Its scary though thats its the blue laser diode production and not the cell production that stuffed up!

oh well more time to save up

_________________
Sven Harvey
Amiga Mart in Micro Mart, Geekology 4M@, and other places
A1000, A2000, A1500 A500, CDTV, A500+, A600, A4000, A1200, CD32, AT A1200HD, A1-XE

@SvenHarvey

Quote:

apparently its our own fault for having too many languages

I was sure people would find a reason _not_ to put the blame on Sony, but on ourselves.
As a first step, I propose that all Europeans learn Finnish, since this will be the new default language for the European PS3... Or Rhaeto-Romanic, I am still debating...

_________________
This signature is in the middle of a much needed facelift!

@polka.

Good I agree every body should learn finnis, why did you propose that?

I can start teaching it, how about 120¤/hour? That would be interesting :) Long words and totally different language thant any other european language, which makes it difficult to learn and of course finnish people have difficult to learn any other european language exept estonian and hungary

My favorit finnis long word is : ratsastajattaritta which means without women who ride the horse

Features that distinguish Finnish from Indo-European languages are:

absence of grammatical gender (also worth noting is that the same Finnish pronoun hän denotes both he and she),
absence of articles (a and the in English),
long words due to the structure of the language,
numerous grammatical cases,
preference of postpositions against prepositions
no equivalent of the verb to have, instead a locative construction is used.

@polka.

Finnish sounds reasonable, if they have anything going on with Nokia, otherwise Swedish, due to the Sony/Ericsson.

_________________
Site admins are people too..pooff!

@utri007

Quote:

My favorit finnis long word is : ratsastajattaritta which means without women who ride the horse

How about saippuakauppias ?
It's the longest word in the world (afaik) that is the same word backwards

Translation: saippuakauppias= a soap-salesman

_________________
Site admins are people too..pooff!

@Aminicle

Well if languages is the reason, I assume that means the UK and Ireland will also get PS3s on schedule.

Not that it matters, I think Sony is an evil company, worse than Microsoft, and I will never ever buy Sony.

@utri007

Quote:

Good I agree every body should learn finnis, why did you propose that?

You already named the reasons! "a totally different language thant any other european language" - so everybody is on the same level (ok, except for the few Finns or Finnish-speaking Europeans )

@tomaszkid
Quote:

How about saippuakauppias ? It's the longest word in the world (afaik) that is the same word backwards

Wow.

What about the longest town and domain name in Britain or the longest place name of the world:
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit.

Last edited by polka. on 07-Sep-2006 at 09:10 AM.

_________________
This signature is in the middle of a much needed facelift!

@polka.

Quote:

What about the longest town and domain name in Britain or the longest place name of the world: Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit.

How do you pronounce that?

Here is a polka for you BTW

(Requires flash)

_________________
Site admins are people too..pooff!

@tomazkid

Quote:

tomazkid wrote: Here is a polka for you BTW (Requires flash)

You have just found the perfect nominee for the next Finnish competitor for the Eurovision Song Contest. After Lordi, we need something totally different

BTW, there is a longer palindrome in Finnish:

saippuakivikauppias

free translation is "the salesman who sells rocks made from soap"

_________________
"Those are my principles, and if you don't like them... well, I have others." (Groucho Marx)

@GrumpyOldMan

Quote:

You have just found the perfect nominee for the next Finnish competitor for the Eurovision Song Contest. After Lordi, we need something totally different

Loituma to the ESC


Quote:

saippuakivikauppias

Heh, it is indeed even longer

_________________
Site admins are people too..pooff!

@SvenHarvey

Quote:

pathetic - and apparently its our own fault for having too many languages, which is why we lost out when the yeilds didn't work out... Its scary though thats its the blue laser diode production and not the cell production that stuffed up!

Eh, how is languages supposed to be related to lacking production of bluray?

Quote:

oh well more time to save up

Or time to give Sony the same finger they continually give their customers.

@tomazkid

saippuakuppinippukauppias

Still a word, but not for every day use ;)


From wikipedia

Saippuakauppias, Finnish for "soap vendor", is claimed to be the world's longest palindromic word in everyday use

Last edited by utri007 on 07-Sep-2006 at 10:17 AM.

This is good for Microsoft, more time to sell more machines and their price is much lower then ps3 for xbox360. I believe sony is waiting for os4 to be finished for it and not the blue laser/layer or what its called. Dont you believe that ? hehe

@Aminicle

Quote:

Aminicle wrote: PS3 delayed till march in Europe ... USA and Jap as planned. ... Always the same with those idiots.

Indeed.. Always Europe that has to suffer.
This might be a very good thing for microsoft and hd-dvd though.

@SvenHarvey

Quote:

SvenHarvey wrote: @Aminicle pathetic - and apparently its our own fault for having too many languages, which is why we lost out when the yeilds didn't work out... Its scary though thats its the blue laser diode production and not the cell production that stuffed up! oh well more time to save up

That is not true at all... Why is it also delayed in for example Australia then? The main thing is that USA is a bigger market. And translating the manuals to a different language is really not what takes time.

@thread

the reason given on ARS Technica was that there weren't enough blue laser diodes to make the blue-ray drives for a global launch.

@polka.

Quote:

polka. wrote: @utri007 What about the longest town and domain name in Britain or the longest place name of the world: Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit.

I tried to fit that name in my "Location" profile and guess what? The whole thread got b0rked and was completely shifted to the right.

Bahhh and what is the problem?

More live to my PS2, more games to come ...